• Home
  • Product
  • About Us
  • News
  • Contact

+(86) 187 5054 6777

Menu
Click to enlarge

Cagrilintide

$0.00

Compare
Add to wishlist
  • Description
Description

Cagrilintide Overview

Cagrilintide is a potent long-acting acylated amylin analogue that effectively targets amylin receptors (AMYR) and calcitonin G protein-coupled receptors (CTR). It has been shown to induce significant weight loss and reduce food intake, making it a highly promising compound for obesity treatment. In vivo studies have demonstrated Cagrilintide’s efficacy in reducing food intake in animal models, with sustained effects over several days. Currently, Cagrilintide is being used in clinical settings to explore its full potential in addressing obesity and related metabolic conditions.

Product Details

  • Sequence:{Eicosanedioic acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 (Disulfide bridge:Cys3-Cys8)
  • Sequence Shortening:{Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8)
  • Molecular Formula:C194H312N54O59S2
  • Molecular Weight:01 g/mol
  • CAS Number:1415456-99-3

Research Highlights

  1. Weight Loss Efficacy:Cagrilintide has demonstrated significant weight loss potential, reducing food intake in animal studies with sustained effects at doses ranging from 1-10 nmol/kg.
  2. Pharmacokinetics:Cagrilintide exhibits favorable pharmacokinetic properties, delivering effective results when administered subcutaneously or intravenously.
  3. Clinical Application:Cagrilintide is actively used in clinical trials to further assess its efficacy in treating obesity, overweight conditions, and related metabolic disorders.
  4. Obesity Treatment Potential:With its dual mechanism of action, Cagrilintide is positioned as a leading option in the fight against obesity, offering a new and promising approach to weight management.
  • Important Notices:
  • This product is sold for scientific research purposes only.

Related products

Compare
Quick view
Add to wishlist

Tirzepatide

$0.00
Add to cart
Compare
Quick view
Add to wishlist

Retatrutide

$0.00
Add to cart
Compare
Quick view
Add to wishlist

Semaglutide

$0.00
Add to cart

Contact us

Zhangzhou Sinobioway Peptide Co.,Ltd.
Phone: +(86)18750546777
Email:SINOPEPT@GMAIL.COM

Address Information

No.518, Nanbin Road, Zhangzhou Economic Development Zone. Fujian, China 363105. China

Quick Chat

  • Facebook
  • WhatsApp
  • YouTube
  • LinkedIn
  • Twitter
All products on this site are for Research, Development use only. Products are Not for Human consumption of any kind.
© 2024 Zhangzhou Sinobioway Peptide Co.,Ltd.. All Rights Reserved.
payments
  • Home
  • Product
  • About Us
  • News
  • Contact
  • Wishlist
  • Compare
  • Login / Register
Shop
Blog
My account

WhatsApp us